PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta012892
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HB-other
Protein Properties Length: 124aa    MW: 14407.3 Da    PI: 9.4392
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-16742PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.8e-19964257
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               +kR+  t++q+e+Le+ +++++yp+++++++L+++lgL+e+qV+ WF  rR k+kk
  Pta012892  9 QKRRLKTPSQVEALENIYAEHKYPTESMKAKLSRELGLSEKQVQRWFRHRRLKDKK 64
               589999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.277565IPR001356Homeobox domain
SMARTSM003891.4E-17869IPR001356Homeobox domain
CDDcd000867.79E-17966No hitNo description
PfamPF000461.3E-16964IPR001356Homeobox domain
SuperFamilySSF466893.67E-18971IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-191073IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MEDKGFVEQK RRLKTPSQVE ALENIYAEHK YPTESMKAKL SRELGLSEKQ VQRWFRHRRL  60
KDKKGKKEEP DSNEELDAGS GSNLQQQQHL VRTEMGRSEK KRLLGISDYP SAVLAAELND  120
HDML
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276612.12e-22PREDICTED: uncharacterized protein LOC104611309
SwissprotF4HY563e-18RLT1_ARATH; Homeobox-DDT domain protein RLT1
TrEMBLD5ABF44e-80D5ABF4_PICSI; Putative uncharacterized protein
STRINGGLYMA04G15260.14e-22(Glycine max)
STRINGVIT_06s0009g03530.t012e-21(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.16e-23HB-other family protein